gget
npx skills add https://github.com/ovachiever/droid-tings --skill gget
Agent 安装分布
Skill 文档
gget
Overview
gget is a command-line bioinformatics tool and Python package providing unified access to 20+ genomic databases and analysis methods. Query gene information, sequence analysis, protein structures, expression data, and disease associations through a consistent interface. All gget modules work both as command-line tools and as Python functions.
Important: The databases queried by gget are continuously updated, which sometimes changes their structure. gget modules are tested automatically on a biweekly basis and updated to match new database structures when necessary.
Installation
Install gget in a clean virtual environment to avoid conflicts:
# Using uv (recommended)
uv uv pip install gget
# Or using pip
uv pip install --upgrade gget
# In Python/Jupyter
import gget
Quick Start
Basic usage pattern for all modules:
# Command-line
gget <module> [arguments] [options]
# Python
gget.module(arguments, options)
Most modules return:
- Command-line: JSON (default) or CSV with
-csvflag - Python: DataFrame or dictionary
Common flags across modules:
-o/--out: Save results to file-q/--quiet: Suppress progress information-csv: Return CSV format (command-line only)
Module Categories
1. Reference & Gene Information
gget ref – Reference Genome Downloads
Retrieve download links and metadata for Ensembl reference genomes.
Parameters:
species: Genus_species format (e.g., ‘homo_sapiens’, ‘mus_musculus’). Shortcuts: ‘human’, ‘mouse’-w/--which: Specify return types (gtf, cdna, dna, cds, cdrna, pep). Default: all-r/--release: Ensembl release number (default: latest)-l/--list_species: List available vertebrate species-liv/--list_iv_species: List available invertebrate species-ftp: Return only FTP links-d/--download: Download files (requires curl)
Examples:
# List available species
gget ref --list_species
# Get all reference files for human
gget ref homo_sapiens
# Download only GTF annotation for mouse
gget ref -w gtf -d mouse
# Python
gget.ref("homo_sapiens")
gget.ref("mus_musculus", which="gtf", download=True)
gget search – Gene Search
Locate genes by name or description across species.
Parameters:
searchwords: One or more search terms (case-insensitive)-s/--species: Target species (e.g., ‘homo_sapiens’, ‘mouse’)-r/--release: Ensembl release number-t/--id_type: Return ‘gene’ (default) or ‘transcript’-ao/--andor: ‘or’ (default) finds ANY searchword; ‘and’ requires ALL-l/--limit: Maximum results to return
Returns: ensembl_id, gene_name, ensembl_description, ext_ref_description, biotype, URL
Examples:
# Search for GABA-related genes in human
gget search -s human gaba gamma-aminobutyric
# Find specific gene, require all terms
gget search -s mouse -ao and pax7 transcription
# Python
gget.search(["gaba", "gamma-aminobutyric"], species="homo_sapiens")
gget info – Gene/Transcript Information
Retrieve comprehensive gene and transcript metadata from Ensembl, UniProt, and NCBI.
Parameters:
ens_ids: One or more Ensembl IDs (also supports WormBase, Flybase IDs). Limit: ~1000 IDs-n/--ncbi: Disable NCBI data retrieval-u/--uniprot: Disable UniProt data retrieval-pdb: Include PDB identifiers (increases runtime)
Returns: UniProt ID, NCBI gene ID, primary gene name, synonyms, protein names, descriptions, biotype, canonical transcript
Examples:
# Get info for multiple genes
gget info ENSG00000034713 ENSG00000104853 ENSG00000170296
# Include PDB IDs
gget info ENSG00000034713 -pdb
# Python
gget.info(["ENSG00000034713", "ENSG00000104853"], pdb=True)
gget seq – Sequence Retrieval
Fetch nucleotide or amino acid sequences for genes and transcripts.
Parameters:
ens_ids: One or more Ensembl identifiers-t/--translate: Fetch amino acid sequences instead of nucleotide-iso/--isoforms: Return all transcript variants (gene IDs only)
Returns: FASTA format sequences
Examples:
# Get nucleotide sequences
gget seq ENSG00000034713 ENSG00000104853
# Get all protein isoforms
gget seq -t -iso ENSG00000034713
# Python
gget.seq(["ENSG00000034713"], translate=True, isoforms=True)
2. Sequence Analysis & Alignment
gget blast – BLAST Searches
BLAST nucleotide or amino acid sequences against standard databases.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-p/--program: blastn, blastp, blastx, tblastn, tblastx (auto-detected)-db/--database:- Nucleotide: nt, refseq_rna, pdbnt
- Protein: nr, swissprot, pdbaa, refseq_protein
-l/--limit: Max hits (default: 50)-e/--expect: E-value cutoff (default: 10.0)-lcf/--low_comp_filt: Enable low complexity filtering-mbo/--megablast_off: Disable MegaBLAST (blastn only)
Examples:
# BLAST protein sequence
gget blast MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# BLAST from file with specific database
gget blast sequence.fasta -db swissprot -l 10
# Python
gget.blast("MKWMFK...", database="swissprot", limit=10)
gget blat – BLAT Searches
Locate genomic positions of sequences using UCSC BLAT.
Parameters:
sequence: Sequence string or path to FASTA/.txt file-st/--seqtype: ‘DNA’, ‘protein’, ‘translated%20RNA’, ‘translated%20DNA’ (auto-detected)-a/--assembly: Target assembly (default: ‘human’/hg38; options: ‘mouse’/mm39, ‘zebrafinch’/taeGut2, etc.)
Returns: genome, query size, alignment positions, matches, mismatches, alignment percentage
Examples:
# Find genomic location in human
gget blat ATCGATCGATCGATCG
# Search in different assembly
gget blat -a mm39 ATCGATCGATCGATCG
# Python
gget.blat("ATCGATCGATCGATCG", assembly="mouse")
gget muscle – Multiple Sequence Alignment
Align multiple nucleotide or amino acid sequences using Muscle5.
Parameters:
fasta: Sequences or path to FASTA/.txt file-s5/--super5: Use Super5 algorithm for faster processing (large datasets)
Returns: Aligned sequences in ClustalW format or aligned FASTA (.afa)
Examples:
# Align sequences from file
gget muscle sequences.fasta -o aligned.afa
# Use Super5 for large dataset
gget muscle large_dataset.fasta -s5
# Python
gget.muscle("sequences.fasta", save=True)
gget diamond – Local Sequence Alignment
Perform fast local protein or translated DNA alignment using DIAMOND.
Parameters:
- Query: Sequences (string/list) or FASTA file path
--reference: Reference sequences (string/list) or FASTA file path (required)--sensitivity: fast, mid-sensitive, sensitive, more-sensitive, very-sensitive (default), ultra-sensitive--threads: CPU threads (default: 1)--diamond_db: Save database for reuse--translated: Enable nucleotide-to-amino acid alignment
Returns: Identity percentage, sequence lengths, match positions, gap openings, E-values, bit scores
Examples:
# Align against reference
gget diamond GGETISAWESQME -ref reference.fasta --threads 4
# Save database for reuse
gget diamond query.fasta -ref ref.fasta --diamond_db my_db.dmnd
# Python
gget.diamond("GGETISAWESQME", reference="reference.fasta", threads=4)
3. Structural & Protein Analysis
gget pdb – Protein Structures
Query RCSB Protein Data Bank for structure and metadata.
Parameters:
pdb_id: PDB identifier (e.g., ‘7S7U’)-r/--resource: Data type (pdb, entry, pubmed, assembly, entity types)-i/--identifier: Assembly, entity, or chain ID
Returns: PDB format (structures) or JSON (metadata)
Examples:
# Download PDB structure
gget pdb 7S7U -o 7S7U.pdb
# Get metadata
gget pdb 7S7U -r entry
# Python
gget.pdb("7S7U", save=True)
gget alphafold – Protein Structure Prediction
Predict 3D protein structures using simplified AlphaFold2.
Setup Required:
# Install OpenMM first
uv pip install openmm
# Then setup AlphaFold
gget setup alphafold
Parameters:
sequence: Amino acid sequence (string), multiple sequences (list), or FASTA file. Multiple sequences trigger multimer modeling-mr/--multimer_recycles: Recycling iterations (default: 3; recommend 20 for accuracy)-mfm/--multimer_for_monomer: Apply multimer model to single proteins-r/--relax: AMBER relaxation for top-ranked modelplot: Python-only; generate interactive 3D visualization (default: True)show_sidechains: Python-only; include side chains (default: True)
Returns: PDB structure file, JSON alignment error data, optional 3D visualization
Examples:
# Predict single protein structure
gget alphafold MKWMFKEDHSLEHRCVESAKIRAKYPDRVPVIVEKVSGSQIVDIDKRKYLVPSDITVAQFMWIIRKRIQLPSEKAIFLFVDKTVPQSR
# Predict multimer with higher accuracy
gget alphafold sequence1.fasta -mr 20 -r
# Python with visualization
gget.alphafold("MKWMFK...", plot=True, show_sidechains=True)
# Multimer prediction
gget.alphafold(["sequence1", "sequence2"], multimer_recycles=20)
gget elm – Eukaryotic Linear Motifs
Predict Eukaryotic Linear Motifs in protein sequences.
Setup Required:
gget setup elm
Parameters:
sequence: Amino acid sequence or UniProt Acc-u/--uniprot: Indicates sequence is UniProt Acc-e/--expand: Include protein names, organisms, references-s/--sensitivity: DIAMOND alignment sensitivity (default: “very-sensitive”)-t/--threads: Number of threads (default: 1)
Returns: Two outputs:
- ortholog_df: Linear motifs from orthologous proteins
- regex_df: Motifs directly matched in input sequence
Examples:
# Predict motifs from sequence
gget elm LIAQSIGQASFV -o results
# Use UniProt accession with expanded info
gget elm --uniprot Q02410 -e
# Python
ortholog_df, regex_df = gget.elm("LIAQSIGQASFV")
4. Expression & Disease Data
gget archs4 – Gene Correlation & Tissue Expression
Query ARCHS4 database for correlated genes or tissue expression data.
Parameters:
gene: Gene symbol or Ensembl ID (with--ensemblflag)-w/--which: ‘correlation’ (default, returns 100 most correlated genes) or ’tissue’ (expression atlas)-s/--species: ‘human’ (default) or ‘mouse’ (tissue data only)-e/--ensembl: Input is Ensembl ID
Returns:
- Correlation mode: Gene symbols, Pearson correlation coefficients
- Tissue mode: Tissue identifiers, min/Q1/median/Q3/max expression values
Examples:
# Get correlated genes
gget archs4 ACE2
# Get tissue expression
gget archs4 -w tissue ACE2
# Python
gget.archs4("ACE2", which="tissue")
gget cellxgene – Single-Cell RNA-seq Data
Query CZ CELLxGENE Discover Census for single-cell data.
Setup Required:
gget setup cellxgene
Parameters:
--gene(-g): Gene names or Ensembl IDs (case-sensitive! ‘PAX7’ for human, ‘Pax7’ for mouse)--tissue: Tissue type(s)--cell_type: Specific cell type(s)--species(-s): ‘homo_sapiens’ (default) or ‘mus_musculus’--census_version(-cv): Version (“stable”, “latest”, or dated)--ensembl(-e): Use Ensembl IDs--meta_only(-mo): Return metadata only- Additional filters: disease, development_stage, sex, assay, dataset_id, donor_id, ethnicity, suspension_type
Returns: AnnData object with count matrices and metadata (or metadata-only dataframes)
Examples:
# Get single-cell data for specific genes and cell types
gget cellxgene --gene ACE2 ABCA1 --tissue lung --cell_type "mucus secreting cell" -o lung_data.h5ad
# Metadata only
gget cellxgene --gene PAX7 --tissue muscle --meta_only -o metadata.csv
# Python
adata = gget.cellxgene(gene=["ACE2", "ABCA1"], tissue="lung", cell_type="mucus secreting cell")
gget enrichr – Enrichment Analysis
Perform ontology enrichment analysis on gene lists using Enrichr.
Parameters:
genes: Gene symbols or Ensembl IDs-db/--database: Reference database (supports shortcuts: ‘pathway’, ‘transcription’, ‘ontology’, ‘diseases_drugs’, ‘celltypes’)-s/--species: human (default), mouse, fly, yeast, worm, fish-bkg_l/--background_list: Background genes for comparison-ko/--kegg_out: Save KEGG pathway images with highlighted genesplot: Python-only; generate graphical results
Database Shortcuts:
- ‘pathway’ â KEGG_2021_Human
- ‘transcription’ â ChEA_2016
- ‘ontology’ â GO_Biological_Process_2021
- ‘diseases_drugs’ â GWAS_Catalog_2019
- ‘celltypes’ â PanglaoDB_Augmented_2021
Examples:
# Enrichment analysis for ontology
gget enrichr -db ontology ACE2 AGT AGTR1
# Save KEGG pathways
gget enrichr -db pathway ACE2 AGT AGTR1 -ko ./kegg_images/
# Python with plot
gget.enrichr(["ACE2", "AGT", "AGTR1"], database="ontology", plot=True)
gget bgee – Orthology & Expression
Retrieve orthology and gene expression data from Bgee database.
Parameters:
ens_id: Ensembl gene ID or NCBI gene ID (for non-Ensembl species). Multiple IDs supported whentype=expression-t/--type: ‘orthologs’ (default) or ‘expression’
Returns:
- Orthologs mode: Matching genes across species with IDs, names, taxonomic info
- Expression mode: Anatomical entities, confidence scores, expression status
Examples:
# Get orthologs
gget bgee ENSG00000169194
# Get expression data
gget bgee ENSG00000169194 -t expression
# Multiple genes
gget bgee ENSBTAG00000047356 ENSBTAG00000018317 -t expression
# Python
gget.bgee("ENSG00000169194", type="orthologs")
gget opentargets – Disease & Drug Associations
Retrieve disease and drug associations from OpenTargets.
Parameters:
- Ensembl gene ID (required)
-r/--resource: diseases (default), drugs, tractability, pharmacogenetics, expression, depmap, interactions-l/--limit: Cap results count- Filter arguments (vary by resource):
- drugs:
--filter_disease - pharmacogenetics:
--filter_drug - expression/depmap:
--filter_tissue,--filter_anat_sys,--filter_organ - interactions:
--filter_protein_a,--filter_protein_b,--filter_gene_b
- drugs:
Examples:
# Get associated diseases
gget opentargets ENSG00000169194 -r diseases -l 5
# Get associated drugs
gget opentargets ENSG00000169194 -r drugs -l 10
# Get tissue expression
gget opentargets ENSG00000169194 -r expression --filter_tissue brain
# Python
gget.opentargets("ENSG00000169194", resource="diseases", limit=5)
gget cbio – cBioPortal Cancer Genomics
Plot cancer genomics heatmaps using cBioPortal data.
Two subcommands:
search – Find study IDs:
gget cbio search breast lung
plot – Generate heatmaps:
Parameters:
-s/--study_ids: Space-separated cBioPortal study IDs (required)-g/--genes: Space-separated gene names or Ensembl IDs (required)-st/--stratification: Column to organize data (tissue, cancer_type, cancer_type_detailed, study_id, sample)-vt/--variation_type: Data type (mutation_occurrences, cna_nonbinary, sv_occurrences, cna_occurrences, Consequence)-f/--filter: Filter by column value (e.g., ‘study_id:msk_impact_2017’)-dd/--data_dir: Cache directory (default: ./gget_cbio_cache)-fd/--figure_dir: Output directory (default: ./gget_cbio_figures)-dpi: Resolution (default: 100)-sh/--show: Display plot in window-nc/--no_confirm: Skip download confirmations
Examples:
# Search for studies
gget cbio search esophag ovary
# Create heatmap
gget cbio plot -s msk_impact_2017 -g AKT1 ALK BRAF -st tissue -vt mutation_occurrences
# Python
gget.cbio_search(["esophag", "ovary"])
gget.cbio_plot(["msk_impact_2017"], ["AKT1", "ALK"], stratification="tissue")
gget cosmic – COSMIC Database
Search COSMIC (Catalogue Of Somatic Mutations In Cancer) database.
Important: License fees apply for commercial use. Requires COSMIC account credentials.
Parameters:
searchterm: Gene name, Ensembl ID, mutation notation, or sample ID-ctp/--cosmic_tsv_path: Path to downloaded COSMIC TSV file (required for querying)-l/--limit: Maximum results (default: 100)
Database download flags:
-d/--download_cosmic: Activate download mode-gm/--gget_mutate: Create version for gget mutate-cp/--cosmic_project: Database type (cancer, census, cell_line, resistance, genome_screen, targeted_screen)-cv/--cosmic_version: COSMIC version-gv/--grch_version: Human reference genome (37 or 38)--email,--password: COSMIC credentials
Examples:
# First download database
gget cosmic -d --email user@example.com --password xxx -cp cancer
# Then query
gget cosmic EGFR -ctp cosmic_data.tsv -l 10
# Python
gget.cosmic("EGFR", cosmic_tsv_path="cosmic_data.tsv", limit=10)
5. Additional Tools
gget mutate – Generate Mutated Sequences
Generate mutated nucleotide sequences from mutation annotations.
Parameters:
sequences: FASTA file path or direct sequence input (string/list)-m/--mutations: CSV/TSV file or DataFrame with mutation data (required)-mc/--mut_column: Mutation column name (default: ‘mutation’)-sic/--seq_id_column: Sequence ID column (default: ‘seq_ID’)-mic/--mut_id_column: Mutation ID column-k/--k: Length of flanking sequences (default: 30 nucleotides)
Returns: Mutated sequences in FASTA format
Examples:
# Single mutation
gget mutate ATCGCTAAGCT -m "c.4G>T"
# Multiple sequences with mutations from file
gget mutate sequences.fasta -m mutations.csv -o mutated.fasta
# Python
import pandas as pd
mutations_df = pd.DataFrame({"seq_ID": ["seq1"], "mutation": ["c.4G>T"]})
gget.mutate(["ATCGCTAAGCT"], mutations=mutations_df)
gget gpt – OpenAI Text Generation
Generate natural language text using OpenAI’s API.
Setup Required:
gget setup gpt
Important: Free tier limited to 3 months after account creation. Set monthly billing limits.
Parameters:
prompt: Text input for generation (required)api_key: OpenAI authentication (required)- Model configuration: temperature, top_p, max_tokens, frequency_penalty, presence_penalty
- Default model: gpt-3.5-turbo (configurable)
Examples:
gget gpt "Explain CRISPR" --api_key your_key_here
# Python
gget.gpt("Explain CRISPR", api_key="your_key_here")
gget setup – Install Dependencies
Install/download third-party dependencies for specific modules.
Parameters:
module: Module name requiring dependency installation-o/--out: Output folder path (elm module only)
Modules requiring setup:
alphafold– Downloads ~4GB of model parameterscellxgene– Installs cellxgene-census (may not support latest Python)elm– Downloads local ELM databasegpt– Configures OpenAI integration
Examples:
# Setup AlphaFold
gget setup alphafold
# Setup ELM with custom directory
gget setup elm -o /path/to/elm_data
# Python
gget.setup("alphafold")
Common Workflows
Workflow 1: Gene Discovery to Sequence Analysis
Find and analyze genes of interest:
# 1. Search for genes
results = gget.search(["GABA", "receptor"], species="homo_sapiens")
# 2. Get detailed information
gene_ids = results["ensembl_id"].tolist()
info = gget.info(gene_ids[:5])
# 3. Retrieve sequences
sequences = gget.seq(gene_ids[:5], translate=True)
Workflow 2: Sequence Alignment and Structure
Align sequences and predict structures:
# 1. Align multiple sequences
alignment = gget.muscle("sequences.fasta")
# 2. Find similar sequences
blast_results = gget.blast(my_sequence, database="swissprot", limit=10)
# 3. Predict structure
structure = gget.alphafold(my_sequence, plot=True)
# 4. Find linear motifs
ortholog_df, regex_df = gget.elm(my_sequence)
Workflow 3: Gene Expression and Enrichment
Analyze expression patterns and functional enrichment:
# 1. Get tissue expression
tissue_expr = gget.archs4("ACE2", which="tissue")
# 2. Find correlated genes
correlated = gget.archs4("ACE2", which="correlation")
# 3. Get single-cell data
adata = gget.cellxgene(gene=["ACE2"], tissue="lung", cell_type="epithelial cell")
# 4. Perform enrichment analysis
gene_list = correlated["gene_symbol"].tolist()[:50]
enrichment = gget.enrichr(gene_list, database="ontology", plot=True)
Workflow 4: Disease and Drug Analysis
Investigate disease associations and therapeutic targets:
# 1. Search for genes
genes = gget.search(["breast cancer"], species="homo_sapiens")
# 2. Get disease associations
diseases = gget.opentargets("ENSG00000169194", resource="diseases")
# 3. Get drug associations
drugs = gget.opentargets("ENSG00000169194", resource="drugs")
# 4. Query cancer genomics data
study_ids = gget.cbio_search(["breast"])
gget.cbio_plot(study_ids[:2], ["BRCA1", "BRCA2"], stratification="cancer_type")
# 5. Search COSMIC for mutations
cosmic_results = gget.cosmic("BRCA1", cosmic_tsv_path="cosmic.tsv")
Workflow 5: Comparative Genomics
Compare proteins across species:
# 1. Get orthologs
orthologs = gget.bgee("ENSG00000169194", type="orthologs")
# 2. Get sequences for comparison
human_seq = gget.seq("ENSG00000169194", translate=True)
mouse_seq = gget.seq("ENSMUSG00000026091", translate=True)
# 3. Align sequences
alignment = gget.muscle([human_seq, mouse_seq])
# 4. Compare structures
human_structure = gget.pdb("7S7U")
mouse_structure = gget.alphafold(mouse_seq)
Workflow 6: Building Reference Indices
Prepare reference data for downstream analysis (e.g., kallisto|bustools):
# 1. List available species
gget ref --list_species
# 2. Download reference files
gget ref -w gtf -w cdna -d homo_sapiens
# 3. Build kallisto index
kallisto index -i transcriptome.idx transcriptome.fasta
# 4. Download genome for alignment
gget ref -w dna -d homo_sapiens
Best Practices
Data Retrieval
- Use
--limitto control result sizes for large queries - Save results with
-o/--outfor reproducibility - Check database versions/releases for consistency across analyses
- Use
--quietin production scripts to reduce output
Sequence Analysis
- For BLAST/BLAT, start with default parameters, then adjust sensitivity
- Use
gget diamondwith--threadsfor faster local alignment - Save DIAMOND databases with
--diamond_dbfor repeated queries - For multiple sequence alignment, use
-s5/--super5for large datasets
Expression and Disease Data
- Gene symbols are case-sensitive in cellxgene (e.g., ‘PAX7’ vs ‘Pax7’)
- Run
gget setupbefore first use of alphafold, cellxgene, elm, gpt - For enrichment analysis, use database shortcuts for convenience
- Cache cBioPortal data with
-ddto avoid repeated downloads
Structure Prediction
- AlphaFold multimer predictions: use
-mr 20for higher accuracy - Use
-rflag for AMBER relaxation of final structures - Visualize results in Python with
plot=True - Check PDB database first before running AlphaFold predictions
Error Handling
- Database structures change; update gget regularly:
uv pip install --upgrade gget - Process max ~1000 Ensembl IDs at once with gget info
- For large-scale analyses, implement rate limiting for API queries
- Use virtual environments to avoid dependency conflicts
Output Formats
Command-line
- Default: JSON
- CSV: Add
-csvflag - FASTA: gget seq, gget mutate
- PDB: gget pdb, gget alphafold
- PNG: gget cbio plot
Python
- Default: DataFrame or dictionary
- JSON: Add
json=Trueparameter - Save to file: Add
save=Trueor specifyout="filename" - AnnData: gget cellxgene
Resources
This skill includes reference documentation for detailed module information:
references/
module_reference.md– Comprehensive parameter reference for all modulesdatabase_info.md– Information about queried databases and their update frequenciesworkflows.md– Extended workflow examples and use cases
For additional help:
- Official documentation: https://pachterlab.github.io/gget/
- GitHub issues: https://github.com/pachterlab/gget/issues
- Citation: Luebbert, L. & Pachter, L. (2023). Efficient querying of genomic reference databases with gget. Bioinformatics. https://doi.org/10.1093/bioinformatics/btac836