pyopenms
npx skills add https://github.com/lifangda/claude-plugins --skill pyopenms
Agent 安装分布
Skill 文档
pyOpenMS
Overview
pyOpenMS is an open-source Python library for mass spectrometry data analysis in proteomics and metabolomics. Process LC-MS/MS data, perform peptide identification, detect and quantify features, and integrate with common proteomics tools (Comet, Mascot, MSGF+, Percolator, MSstats) using Python bindings to the OpenMS C++ library.
When to Use This Skill
This skill should be used when:
- Processing mass spectrometry data (mzML, mzXML files)
- Performing peak picking and feature detection in LC-MS data
- Conducting peptide and protein identification workflows
- Quantifying metabolites or proteins
- Integrating proteomics or metabolomics tools into Python pipelines
- Working with OpenMS tools and file formats
Core Capabilities
1. File I/O and Data Import/Export
Handle diverse mass spectrometry file formats efficiently:
Supported Formats:
- mzML/mzXML: Primary raw MS data formats (profile or centroid)
- FASTA: Protein/peptide sequence databases
- mzTab: Standardized reporting format for identification and quantification
- mzIdentML: Peptide and protein identification data
- TraML: Transition lists for targeted experiments
- pepXML/protXML: Search engine results
Reading mzML Files:
import pyopenms as oms
# Load MS data
exp = oms.MSExperiment()
oms.MzMLFile().load("input_data.mzML", exp)
# Access basic information
print(f"Number of spectra: {exp.getNrSpectra()}")
print(f"Number of chromatograms: {exp.getNrChromatograms()}")
Writing mzML Files:
# Save processed data
oms.MzMLFile().store("output_data.mzML", exp)
File Encoding: pyOpenMS automatically handles Base64 encoding, zlib compression, and Numpress compression internally.
2. MS Data Structures and Manipulation
Work with core mass spectrometry data structures. See references/data_structures.md for comprehensive details.
MSSpectrum – Individual mass spectrum:
# Create spectrum with metadata
spectrum = oms.MSSpectrum()
spectrum.setRT(205.2) # Retention time in seconds
spectrum.setMSLevel(2) # MS2 spectrum
# Set peak data (m/z, intensity arrays)
mz_array = [100.5, 200.3, 300.7, 400.2]
intensity_array = [1000, 5000, 3000, 2000]
spectrum.set_peaks((mz_array, intensity_array))
# Add precursor information for MS2
precursor = oms.Precursor()
precursor.setMZ(450.5)
precursor.setCharge(2)
spectrum.setPrecursors([precursor])
MSExperiment – Complete LC-MS/MS run:
# Create experiment and add spectra
exp = oms.MSExperiment()
exp.addSpectrum(spectrum)
# Access spectra
first_spectrum = exp.getSpectrum(0)
for spec in exp:
print(f"RT: {spec.getRT()}, MS Level: {spec.getMSLevel()}")
MSChromatogram – Extracted ion chromatogram:
# Create chromatogram
chrom = oms.MSChromatogram()
chrom.set_peaks(([10.5, 11.2, 11.8], [1000, 5000, 3000])) # RT, intensity
exp.addChromatogram(chrom)
Efficient Peak Access:
# Get peaks as numpy arrays for fast processing
mz_array, intensity_array = spectrum.get_peaks()
# Modify and set back
intensity_array *= 2 # Double all intensities
spectrum.set_peaks((mz_array, intensity_array))
3. Chemistry and Peptide Handling
Perform chemical calculations for proteomics and metabolomics. See references/chemistry.md for detailed examples.
Molecular Formulas and Mass Calculations:
# Create empirical formula
formula = oms.EmpiricalFormula("C6H12O6") # Glucose
print(f"Monoisotopic mass: {formula.getMonoWeight()}")
print(f"Average mass: {formula.getAverageWeight()}")
# Formula arithmetic
water = oms.EmpiricalFormula("H2O")
dehydrated = formula - water
# Isotope-specific formulas
heavy_carbon = oms.EmpiricalFormula("(13)C6H12O6")
Isotopic Distributions:
# Generate coarse isotope pattern (unit mass resolution)
coarse_gen = oms.CoarseIsotopePatternGenerator()
pattern = coarse_gen.run(formula)
# Generate fine structure (high resolution)
fine_gen = oms.FineIsotopePatternGenerator(0.01) # 0.01 Da resolution
fine_pattern = fine_gen.run(formula)
Amino Acids and Residues:
# Access residue information
res_db = oms.ResidueDB()
leucine = res_db.getResidue("Leucine")
print(f"L monoisotopic mass: {leucine.getMonoWeight()}")
print(f"L formula: {leucine.getFormula()}")
print(f"L pKa: {leucine.getPka()}")
Peptide Sequences:
# Create peptide sequence
peptide = oms.AASequence.fromString("PEPTIDE")
print(f"Peptide mass: {peptide.getMonoWeight()}")
print(f"Formula: {peptide.getFormula()}")
# Add modifications
modified = oms.AASequence.fromString("PEPTIDEM(Oxidation)")
print(f"Modified mass: {modified.getMonoWeight()}")
# Theoretical fragmentation
ions = []
for i in range(1, peptide.size()):
b_ion = peptide.getPrefix(i)
y_ion = peptide.getSuffix(i)
ions.append(('b', i, b_ion.getMonoWeight()))
ions.append(('y', i, y_ion.getMonoWeight()))
Protein Digestion:
# Enzymatic digestion
dig = oms.ProteaseDigestion()
dig.setEnzyme("Trypsin")
dig.setMissedCleavages(2)
protein_seq = oms.AASequence.fromString("MKTAYIAKQRQISFVKSHFSRQLEERLGLIEVQAPILSRVGDGTQDNLSGAEK")
peptides = []
dig.digest(protein_seq, peptides)
for pep in peptides:
print(f"{pep.toString()}: {pep.getMonoWeight():.2f} Da")
Modifications:
# Access modification database
mod_db = oms.ModificationsDB()
oxidation = mod_db.getModification("Oxidation")
print(f"Oxidation mass diff: {oxidation.getDiffMonoMass()}")
print(f"Residues: {oxidation.getResidues()}")
4. Signal Processing and Filtering
Apply algorithms to process and filter MS data. See references/algorithms.md for comprehensive coverage.
Spectral Smoothing:
# Gaussian smoothing
gauss_filter = oms.GaussFilter()
params = gauss_filter.getParameters()
params.setValue("gaussian_width", 0.2)
gauss_filter.setParameters(params)
gauss_filter.filterExperiment(exp)
# Savitzky-Golay filter
sg_filter = oms.SavitzkyGolayFilter()
sg_filter.filterExperiment(exp)
Peak Filtering:
# Keep only N largest peaks per spectrum
n_largest = oms.NLargest()
params = n_largest.getParameters()
params.setValue("n", 100) # Keep top 100 peaks
n_largest.setParameters(params)
n_largest.filterExperiment(exp)
# Threshold filtering
threshold_filter = oms.ThresholdMower()
params = threshold_filter.getParameters()
params.setValue("threshold", 1000.0) # Remove peaks below 1000 intensity
threshold_filter.setParameters(params)
threshold_filter.filterExperiment(exp)
# Window-based filtering
window_filter = oms.WindowMower()
params = window_filter.getParameters()
params.setValue("windowsize", 50.0) # 50 m/z windows
params.setValue("peakcount", 10) # Keep 10 highest per window
window_filter.setParameters(params)
window_filter.filterExperiment(exp)
Spectrum Normalization:
normalizer = oms.Normalizer()
normalizer.filterExperiment(exp)
MS Level Filtering:
# Keep only MS2 spectra
exp.filterMSLevel(2)
# Filter by retention time range
exp.filterRT(100.0, 500.0) # Keep RT between 100-500 seconds
# Filter by m/z range
exp.filterMZ(400.0, 1500.0) # Keep m/z between 400-1500
5. Feature Detection and Quantification
Detect and quantify features in LC-MS data:
Peak Picking (Centroiding):
# Convert profile data to centroid
picker = oms.PeakPickerHiRes()
params = picker.getParameters()
params.setValue("signal_to_noise", 1.0)
picker.setParameters(params)
exp_centroided = oms.MSExperiment()
picker.pickExperiment(exp, exp_centroided)
Feature Detection:
# Detect features across LC-MS runs
feature_finder = oms.FeatureFinderMultiplex()
features = oms.FeatureMap()
feature_finder.run(exp, features, params)
print(f"Found {features.size()} features")
for feature in features:
print(f"m/z: {feature.getMZ():.4f}, RT: {feature.getRT():.2f}, "
f"Intensity: {feature.getIntensity():.0f}")
Feature Linking (Map Alignment):
# Link features across multiple samples
feature_grouper = oms.FeatureGroupingAlgorithmQT()
consensus_map = oms.ConsensusMap()
# Provide multiple feature maps from different samples
feature_maps = [features1, features2, features3]
feature_grouper.group(feature_maps, consensus_map)
6. Peptide Identification Workflows
Integrate with search engines and process identification results:
Database Searching:
# Prepare parameters for search engine
params = oms.Param()
params.setValue("database", "uniprot_human.fasta")
params.setValue("precursor_mass_tolerance", 10.0) # ppm
params.setValue("fragment_mass_tolerance", 0.5) # Da
params.setValue("enzyme", "Trypsin")
params.setValue("missed_cleavages", 2)
# Variable modifications
params.setValue("variable_modifications", ["Oxidation (M)", "Phospho (STY)"])
# Fixed modifications
params.setValue("fixed_modifications", ["Carbamidomethyl (C)"])
FDR Control:
# False discovery rate estimation
fdr = oms.FalseDiscoveryRate()
fdr_threshold = 0.01 # 1% FDR
# Apply to peptide identifications
protein_ids = []
peptide_ids = []
oms.IdXMLFile().load("search_results.idXML", protein_ids, peptide_ids)
fdr.apply(protein_ids, peptide_ids)
7. Metabolomics Workflows
Analyze small molecule data:
Adduct Detection:
# Common metabolite adducts
adducts = ["[M+H]+", "[M+Na]+", "[M+K]+", "[M-H]-", "[M+Cl]-"]
# Feature annotation with adducts
for feature in features:
mz = feature.getMZ()
# Calculate neutral mass for each adduct hypothesis
for adduct in adducts:
# Annotation logic
pass
Isotope Pattern Matching:
# Compare experimental to theoretical isotope patterns
experimental_pattern = [] # Extract from feature
theoretical = coarse_gen.run(formula)
# Calculate similarity score
similarity = compare_isotope_patterns(experimental_pattern, theoretical)
8. Quality Control and Visualization
Monitor data quality and visualize results:
Basic Statistics:
# Calculate TIC (Total Ion Current)
tic_values = []
rt_values = []
for spectrum in exp:
if spectrum.getMSLevel() == 1:
tic = sum(spectrum.get_peaks()[1]) # Sum intensities
tic_values.append(tic)
rt_values.append(spectrum.getRT())
# Base peak chromatogram
bpc_values = []
for spectrum in exp:
if spectrum.getMSLevel() == 1:
max_intensity = max(spectrum.get_peaks()[1]) if spectrum.size() > 0 else 0
bpc_values.append(max_intensity)
Plotting (with pyopenms.plotting or matplotlib):
import matplotlib.pyplot as plt
# Plot TIC
plt.figure(figsize=(10, 4))
plt.plot(rt_values, tic_values)
plt.xlabel('Retention Time (s)')
plt.ylabel('Total Ion Current')
plt.title('TIC')
plt.show()
# Plot single spectrum
spectrum = exp.getSpectrum(0)
mz, intensity = spectrum.get_peaks()
plt.stem(mz, intensity, basefmt=' ')
plt.xlabel('m/z')
plt.ylabel('Intensity')
plt.title(f'Spectrum at RT {spectrum.getRT():.2f}s')
plt.show()
Common Workflows
Complete LC-MS/MS Processing Pipeline
import pyopenms as oms
# 1. Load data
exp = oms.MSExperiment()
oms.MzMLFile().load("raw_data.mzML", exp)
# 2. Filter and smooth
exp.filterMSLevel(1) # Keep only MS1 for feature detection
gauss = oms.GaussFilter()
gauss.filterExperiment(exp)
# 3. Peak picking
picker = oms.PeakPickerHiRes()
exp_centroid = oms.MSExperiment()
picker.pickExperiment(exp, exp_centroid)
# 4. Feature detection
ff = oms.FeatureFinderMultiplex()
features = oms.FeatureMap()
ff.run(exp_centroid, features, oms.Param())
# 5. Export results
oms.FeatureXMLFile().store("features.featureXML", features)
print(f"Detected {features.size()} features")
Theoretical Peptide Mass Calculation
# Calculate masses for peptide with modifications
peptide = oms.AASequence.fromString("PEPTIDEK")
print(f"Unmodified [M+H]+: {peptide.getMonoWeight() + 1.007276:.4f}")
# With modification
modified = oms.AASequence.fromString("PEPTIDEM(Oxidation)K")
print(f"Oxidized [M+H]+: {modified.getMonoWeight() + 1.007276:.4f}")
# Calculate for different charge states
for z in [1, 2, 3]:
mz = (peptide.getMonoWeight() + z * 1.007276) / z
print(f"[M+{z}H]^{z}+: {mz:.4f}")
Installation
Ensure pyOpenMS is installed before using this skill:
# Via conda (recommended)
conda install -c bioconda pyopenms
# Via pip
pip install pyopenms
Integration with Other Tools
pyOpenMS integrates seamlessly with:
- Search Engines: Comet, Mascot, MSGF+, MSFragger, Sage, SpectraST
- Post-processing: Percolator, MSstats, Epiphany
- Metabolomics: SIRIUS, CSI:FingerID
- Data Analysis: Pandas, NumPy, SciPy for downstream analysis
- Visualization: Matplotlib, Seaborn for plotting
Resources
references/
Detailed documentation on core concepts:
- data_structures.md – Comprehensive guide to MSExperiment, MSSpectrum, MSChromatogram, and peak data handling
- algorithms.md – Complete reference for signal processing, filtering, feature detection, and quantification algorithms
- chemistry.md – In-depth coverage of chemistry calculations, peptide handling, modifications, and isotope distributions
Load these references when needing detailed information about specific pyOpenMS capabilities.
Best Practices
- File Format: Always use mzML for raw MS data (standardized, well-supported)
- Peak Access: Use
get_peaks()andset_peaks()with numpy arrays for efficient processing - Parameters: Always check and configure algorithm parameters via
getParameters()andsetParameters() - Memory: For large datasets, process spectra iteratively rather than loading entire experiments
- Validation: Check data integrity (MS levels, RT ordering, precursor information) after loading
- Modifications: Use standard modification names from UniMod database
- Units: RT in seconds, m/z in Thomson (Da/charge), intensity in arbitrary units
Common Patterns
Algorithm Application Pattern:
# 1. Instantiate algorithm
algorithm = oms.SomeAlgorithm()
# 2. Get and configure parameters
params = algorithm.getParameters()
params.setValue("parameter_name", value)
algorithm.setParameters(params)
# 3. Apply to data
algorithm.filterExperiment(exp) # or .process(), .run(), depending on algorithm
File I/O Pattern:
# Read
data_container = oms.DataContainer() # MSExperiment, FeatureMap, etc.
oms.FileHandler().load("input.format", data_container)
# Process
# ... manipulate data_container ...
# Write
oms.FileHandler().store("output.format", data_container)
Getting Help
- Documentation: https://pyopenms.readthedocs.io/
- API Reference: Browse class documentation for detailed method signatures
- OpenMS Website: https://www.openms.org/
- GitHub Issues: https://github.com/OpenMS/OpenMS/issues